Company Listing Page
check_circle

Established in the year 2022 at Raipur (Chhattisgarh, India), we “Earth Motors” are a leading Wholesaler of a wide range of USED Tractor & Harvesters, Combine Harvester ,Tractor Front end Loaders,Trailors, ,Bellers,Implements, etc.

Business Type : Company
Address : Mandhar Industrial Area, Mandhar Industrial Area, Dist. Raipur, Chhattisgarh, India
Email : earthmotors@mail.com
Website :
check_circle

Business Type : Company
Address : Indore, Madhya Pradesh, India
Email : engineeringwalaironproductpvtltd@mail.com
Website :
check_circle

Agrifarma Machinery Private Limited is a trusted name in the agricultural and gardening equipment industry, offering a premium range of high-performance tools and machinery. Our product portfolio includes earth augers, lawn mowers, brush cutter machines, power weeders, and petrol engine water pumps—all designed to enhance efficiency, reduce labor, and deliver reliable results in the field or garden. Each product is built using quality materials and advanced technology to ensure durability, ease of use, and optimal performance. Whether it's drilling holes with precision, maintaining lawns, clearing weeds, or pumping water efficiently, Agrifarma Machinery provides solutions tailored to the needs of farmers, landscapers, and gardeners. With a commitment to effective and timely delivery, we ensure that our customers receive the right equipment when they need it most. At Agrifarma Machinery Private Limited, we combine innovation, quality, and service to help you work smarter and achieve more.

Business Type : Company
Address : Jaipur, Rajasthan, India
Email : agrifarmamachineryprivatelimited@mail.com
Website :
check_circle

Established in the year 1985, we "Vashisht Enterprises" are one of the leading Manufacturer, Wholesaler, Service Provider & Trader of Handheld Inkjet Printers, Batch Coding Machines, Coding Machines, Coding And Batch Printing Machines, Industrial Inkjet Printers, Continuous Inkjet Printers, Solvent Inks, RO Purifiers and many more. Our claim to success is hallmarked by the offered quality products that gained us huge recognizance. We are working towards development through a determined team of people to meet the most stringent requirements of customers.We have gained a commendable position in the industry by manufacturing quality oriented products. We maintain a high standard of quality in the production process so that the finished product is defectless and strong. Owing to our prompt delivery, and client-centric approach; we have increased the list of our satisfied clients. Additionally, we have a research & development unit, which is engaged in designing upgraded range to cater the needs of the patrons.Under the leadership of our mentor, "Mr. Punit Kumar Sharma", we have been able to attain a commendable position in this domain. His excellent management skills, profound experience, and innovative business ideas has helped us in catering to the huge clientele across the nation.

Business Type : Company
Address : Ghaziabad, Uttar Pradesh, India
Email : vashishtenterprises@mail.com
Website :
check_circle

Since 2005, Royal Pack Industries we are dealing in packaging industry, we introduce ourselves as one of the best Packaging machine manufacture, wholesaler and trader in India. Today Royal pack industries is setting new standards in the manufacturing of packaging machines all across the india. Our in-house R&;;D facilities, rich industrial experience & expertise in Packaging Machines has given us a cutting edge for understanding your packing requirements & providing customized solutions. We offer a comprehensive range of world-class Packaging Machines that are renowned for their high-precision, durability, technical superiority, trouble-free, consistent and high-speed packaging at a very economical rate. With a very good team of after sales service, our customers are guaranteed complete satisfaction.

Business Type : Company
Address : Mumbai, Goregaon East, Mumbai, Maharashtra, India
Email : royalpackindustries@mail.com
Website :
check_circle

We "Shriyansh Impex" are leading Importer & Supplier of Ultrasonic Booster And Horn, Non Woven Bag Machines, Ultrasonic Generator Box, Motor Driver, Power Card, Photoelectric Sensor, Printing Machine, Transistor Circuit Card, Electric Brake Motor and many more.

Business Type : Company
Address : New Delhi, Rohini Sector 15, New Delhi, Delhi, India
Email : shriyanshimpex@mail.com
Website :
check_circle

Super Bright Engineering Company has gained a unique place in the market for offering our clients with an extensive range of self adhesive tapes and packaging consumables. With our vast experience of 27 years in this field, we are engaged in the successful exporting and supplying with a wide assortment of Surface Protection Film, Self Adhesive tapes, Poly Olefin Film (Shrink film), PET, PP and Steel Strapping and Cling & Stretch Wrap Film. Apart from all these we also offer Air Bubble & Foam, Coil Nails for Nailer, PVC Curtain, Marking Ink, Self Lock Bag, Heat Sealer (Polythene) and Glue Sticks. We also lend our service as project consultants to various companies. A strict quality check and a customer oriented approach are followed in our business that helps us to firmly stand in this competitive market within a short span of time. Our in-house facilities help us in meeting the dynamic requirements of all our clients. All products are sourced from the well-known brands of the market like Waco, Taco, Kaymo, RMCL, Supreme, Tesa, Panfix, Cellux, Nichiban, Eagle Tools, Cyklop, Abro, Sevana, Bosch, Metabo, OMEGA, Packex, Tapeline,Packline, NIYO, YBICO, MIP,Wonder, AIPL, Apollo, CROWN, PEPCEE and many more

Business Type : Company
Address : Bengaluru, Wilson Garden, Bengaluru, Karnataka, India
Email : superbrightengineeringco@mail.com
Website :
check_circle

Came into existence in the year 2011, we, Global Pack Machinery, are considered to be one of the leading manufacturers and suppliers of Filling and Sealing Machines. We offer a wide range of products such as Band Sealer Machines, Shrink Wrapping Machines and Sealer Machines. For the purpose of manufacturing the offered range of filling and sealing machines, we make use of quality assured materials. Manufactured as per the industry laid norms, these filling and sealing machines are highly demanded in food processing, chemical and pharmaceutical industries for packaging purposes. Since the inception of our company, we have been backed and supported by a state-of-the-art infrastructure. Our infrastructure is well-equipped with latest machinery and it is known for its large scale production. For the purpose of meeting the precise needs and requirements of our clients, we offer these filling and sealing machines in various sizes and designs. We have appointed a team of skilled machine operators, to manage different units of our infrastructure in the most efficient manner.

Business Type : Company
Address : Vasai, Vasai, Dist. Palghar, Maharashtra, India
Email : globalpackmachinery@mail.com
Website :
check_circle

Established and started its operations in the year 2005, we, an certified Mandsorwala Packaging, are known for manufacturing, supplying, trading and importing the best quality of Packing Machines and Tools. The product range offered by us consists of Battery Operated Pet Strapping Machines, Pneumatic Strapping Tools and Pneumatic Coil Nailer & Stapler. These tools and machines are highly demanded in food processing, chemical and pharmaceutical companies for different packaging purposes. Rendered by us at industry leading prices, these packaging machines and tools are highly appreciated among our patrons. The offered packaging machines and tools are available with us in user-defined specifications. By meeting the bulk demands, we have attained a commendable position in this domain. With the aid of wide distribution network and excellent transportation facility, we ensure a timely delivery of the offered range. Reliance Industries Ltd. is one of the key patrons associated with us over a long period of time. Some of the countries where we export our product range are Africa, USA, East Asia, Mid Europe, Indonesia and Australia.

Business Type : Company
Address : Vadodara, Gujarat, India
Email : mandsorwalapackaging@mail.com
Website :
check_circle

Established in 1995 , our products are widely spread across various categories like OFFICE STATIONERY HOT MELT GLUE GUNS HOT MELT ADHESIVE GLUE STICKS HOT MELT ADHESIVES SNAP OFF CUTTER BLADES SNAP OFF CUTTER KNIFE SAFETY KNIFE PACKAGING TAPE DISPENSERS CASH COUNTING MACHINE PAPER SHREDDERS; which cater to needs of several markets across India. We are committed to stay true to our beliefs of QUALITY RELIABILITY TRANSPARENCY LOYALTY To make quality products that bring customer satisfaction To ensure value pricing for our products To partner with our dealers / distributors to make our products available via offline & online platforms OUR STRENGTH - 500+ DIRECT DEALER CUSTOMER 10000+ SQFT. WAREHOUSE500+ SQFT. SERVICE CENTRE ADMIN OFFICE IN HEARTOF BUSINESS DISTRICT 4 TOP INTERNATIONAL BRANDS

Business Type : Company
Address : Mumbai, Maharashtra, India
Email : niyoimpex@mail.com
Website :

To Get Instant Response

Post Your Requirement

By clicking Submit, I accept the T&C and Privacy Policy.

Attract more buyers

Improve your visibility in

10 Minutes